missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GLYATL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | GLYATL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GLYATL2 Polyclonal specifically detects GLYATL2 in Human samples. It is validated for Western Blot.Specifications
| GLYATL2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Acyl-CoA:glycine N-acyltransferase-like protein 2, BXMAS2-10, EC 2.3.1.13, GATF-B, glycine acyltransferase family-B, glycine N-acyltransferase-like protein 2, glycine-N-acyltransferase-like 2, MGC24009 | |
| GLYATL2 | |
| IgG | |
| 34 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8WU03 | |
| 219970 | |
| Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title