missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glutamate Dehydrogenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54700-25ul
This item is not returnable.
View return policy
Description
Glutamate Dehydrogenase Polyclonal antibody specifically detects Glutamate Dehydrogenase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
Specifications
| Glutamate Dehydrogenase | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 1.4.1, EC 1.4.1.3, GDH, GDH 1, GDH1, GLUD, glutamate dehydrogenase (NAD(P)+), glutamate dehydrogenase 1, glutamate dehydrogenase 1, mitochondrial, MGC132003 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of human Glutamate Dehydrogenase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GLUD1 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKN | |
| 25 μL | |
| Cellular Markers, Diabetes Research, Mitochondrial Markers, Neuroscience | |
| 2746 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction