missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 500.00€
Specifications
| Antigen | Glut2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217131
|
Novus Biologicals
NBP2-58182 |
100 μL |
500.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607196
|
Novus Biologicals
NBP2-58182-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Glut2 Polyclonal specifically detects Glut2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Glut2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Stem Cell Signaling Pathway | |
| GLUT-2, GLUT2 Glucose transporter type 2, liver, SLC2A2, solute carrier family 2 (facilitated glucose transporter), member 2, solute carrier family 2, facilitated glucose transporter member 2 | |
| SLC2A2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 6514 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title