missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ GFER (Human) Recombinant Protein

Abnova™ GFER (Human) Recombinant Protein

Código de producto. 16195421
Click to view available options
Quantity:
10 μg
25 μg
Tamaño de la unidad:
10µg
25µg
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16195421

Marca: Abnova™ H00002671P01.25ug

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Human GFER full-length ORF ( AAH28348, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Especificaciones

Accession Number AAH28348
Gene ID (Entrez) 2671
Name growth factor, augmenter of liver regeneration
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 25 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias ALR, ERV1, HERV1, HPO, HPO1, HPO2, HSS
Gene Symbol GFER
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado