missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GFER (Human) Recombinant Protein
Human GFER full-length ORF ( AAH28348, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00002671-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Specifications
| AAH28348 | |
| growth factor, augmenter of liver regeneration | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GFER | |
| GST |
| 2671 | |
| Wheat germ expression system | |
| 25 μg | |
| ALR, ERV1, HERV1, HPO, HPO1, HPO2, HSS | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |