missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GCDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | GCDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GCDH Polyclonal specifically detects GCDH in Human samples. It is validated for Western Blot.Specifications
| GCDH | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| ACAD5, EC 1.3.99, EC 1.3.99.7, GCD, glutaryl-CoA dehydrogenase, glutaryl-CoA dehydrogenase, mitochondrial, glutaryl-Coenzyme A dehydrogenase | |
| GCDH | |
| IgG | |
| 43 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92947 | |
| 2639 | |
| Synthetic peptides corresponding to GCDH(glutaryl-Coenzyme A dehydrogenase) The peptide sequence was selected from the N terminal of GCDH. Peptide sequence SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title