missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GBAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 528.15€
Specifications
| Antigen | GBAS |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18642766
|
Novus Biologicals
NBP2-38984-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18133258
|
Novus Biologicals
NBP2-38984 |
0.1 mL |
559.00€ 528.15€ / 0.10mL Save 30.85€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GBAS Polyclonal specifically detects GBAS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| GBAS | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O75323 | |
| 2631 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| glioblastoma amplified sequence, Glioblastoma-amplified sequence, NIPSNAP2NipSnap2,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2, protein NipSnap homolog 2 | |
| NIPSNAP2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title