missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. G5pr Antibody, Novus Biologicals™

G5pr Antibody, Novus Biologicals™

Product Code. 18285505 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18285505 100 μL 100µL
18617217 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18285505 Supplier Novus Biologicals Supplier No. NBP258168

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

G5pr Polyclonal specifically detects G5pr in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen G5pr
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias C14orf10, chromosome 14 open reading frame 10, FLJ20644, G4-1, G5pr, protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma, protein phosphatase 2, regulatory subunit B'', gamma, Protein phosphatase subunit G5PR, rhabdomyosarcoma antigen MU-RMS-40.6A, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C, rhabdomyosarcoma antigen Mu-RMS-40.6C, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
Gene Symbols PPP2R3C
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINYENF
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55012
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.