missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FLJ13912 Recombinant Protein

Brand:  Abnova™ H00064785-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103733

  • 335.00€ / 10µg
Estimated Shipment: 28-08-2024
to see stock.
Add to basket

Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH05879
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
49.28
8
Glutathione Sepharose 4 Fast Flow
10 ug
MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQTFIGRFRRIMDSSQNAYSEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED
FLJ13912/PSF3
GINS3
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
64785
FLJ13912 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GINS3
Human
Recombinant
Solution
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers