missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Filamin B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37996-20ul
This item is not returnable.
View return policy
Description
Filamin B Polyclonal antibody specifically detects Filamin B in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| Filamin B | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:20 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:100 | |
| ABP-278filamin B, beta (actin binding protein 278), ABP-280 homolog, actin binding protein 278, Actin-binding-like protein, AOI, Beta-filamin, DKFZp686O033, Fh1, filamin B, beta, Filamin homolog 1, filamin-3, filamin-B, FLN1L, FLN3, FLN-B, Larsen syndrome 1 (autosomal dominant), LRS1, SCT, TABPABP-280, TAPDKFZp686A1668, Thyroid autoantigen, Truncated ABP, Truncated actin-binding protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1686-1785 of human Filamin B (NP_001157789.1).,, Sequence:, PDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFA | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 2317 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction