missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62694
This item is not returnable.
View return policy
Description
FGF-11 Polyclonal antibody specifically detects FGF-11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| FGF-11 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN | |
| 100 μg | |
| Angiogenesis, Neuroscience | |
| 2256 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction