missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-62694-25ul
Les retours ne sont pas autorisés pour ce produit.
Consulta la politica di reso
Descrizione
FGF-11 Polyclonal antibody specifically detects FGF-11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifica
| FGF-11 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| FGF-11, FHF-3, FHF3Fibroblast growth factor homologous factor 3, fibroblast growth factor 11, FLJ16061, MGC102953, MGC45269 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN | |
| 25 μL | |
| Angiogenesis, Neuroscience | |
| 2256 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto