missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RBM4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80469
This item is not returnable.
View return policy
Description
RBM4B Polyclonal specifically detects RBM4B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| RBM4B | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| MGC10871, RBM30, RBM4L, RNA binding motif protein 30, RNA binding motif protein 4B, RNA-binding motif protein 30, RNA-binding motif protein 4B, RNA-binding protein 30, RNA-binding protein 4B, ZCCHC15, ZCRB3B, zinc finger CCHC-type and RNA binding motif 3B | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 83759 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| NP_113680 | |
| RBM4B | |
| Synthetic peptide directed towards the C terminal of human RBM4B. Peptide sequence AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Pig: 100%; Canine: 92%; Mouse: 85%; Rat: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction