missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FANCM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | FANCM |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202065
|
Novus Biologicals
NBP2-55444 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643408
|
Novus Biologicals
NBP2-55444-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FANCM Polyclonal specifically detects FANCM in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FANCM | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Epigenetics | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 57697 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ATP-dependent RNA helicase FANCM, EC 3.6.1, FAAP250EC 3.6.4.13, Fanconi anemia, complementation group M, Fanconi anemia-associated polypeptide of 250 kDa, KIAA1596Fanconi anemia group M protein, MGC176453, Protein FACM, Protein Hef ortholog | |
| FANCM | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title