missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM195B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00€ - 590.10€
Specifications
| Antigen | FAM195B |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18481161
|
Novus Biologicals
NBP2-14550-25ul |
25ul |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18167741
|
Novus Biologicals
NBP2-14550 |
0.1 mL |
624.00€ 590.10€ / 0.10mL Save 33.90€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAM195B Polyclonal specifically detects FAM195B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| FAM195B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FAM195B family with sequence similarity 195, member B | |
| MCRIP1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 348262 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: VRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKVPNPSLKTFKPIDLSDLKRRSTQDAKKS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title