missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM163B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€
Specifications
| Antigen | FAM163B |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
FAM163B Polyclonal specifically detects FAM163B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FAM163B | |
| Unconjugated | |
| RUO | |
| C9orf166, Chromosome 9 Open Reading Frame 166, Family With Sequence Similarity 163, Member B, Protein FAM163B | |
| FAM163B | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 642968 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title