missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM13B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | FAM13B1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18242582
|
Novus Biologicals
NBP2-57951 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619026
|
Novus Biologicals
NBP2-57951-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAM13B1 Polyclonal specifically detects FAM13B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FAM13B1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| C5orf5, chromosome 5 open reading frame 5, DKFZp667F249, FAM13B1, family with sequence similarity 13, member B, family with sequence similarity 13, member B1, FLJ26735, GAP-like protein N61, hypothetical protein LOC51306, KHCHP, MGC57159, N61 | |
| FAM13B | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 51306 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title