missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 590.10€
Specifications
| Antigen | EXOC6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18276342
|
Novus Biologicals
NBP2-56157 |
100 μL |
624.00€ 590.10€ / 100µL Save 33.90€ 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18682757
|
Novus Biologicals
NBP2-56157-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EXOC6 Polyclonal specifically detects EXOC6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| EXOC6 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p | |
| EXOC6 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 54536 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LKEQMSAKRYYSALKTMEQLENVYFPWVSQYRFCQLMIENLPKLREDIKEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title