missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
EXOC2 Monoclonal antibody specifically detects EXOC2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | EXOC2 |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:200 - 1:500, ELISA Recommended starting concentration is 1 μg/mL |
| Formulation | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Gene Alias | exocyst complex component 2, Exocyst complex component Sec5, FLJ11026, SEC5, SEC5L1, SEC5-like 1, SEC5-like 1 (S. cerevisiae), Sec5p |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EXOC2 (NP_060773.3).,, Sequence:, MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGI |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?