missing translation for 'onlineSavingsMsg'
Learn More

ETS2 Antibody, Novus Biologicals™

Product Code. 30227787 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30227787 100 μL 100µL
30227394 20 μL 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 30227787 Supplier Novus Biologicals Supplier No. NBP335702100ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ETS2 Polyclonal antibody specifically detects ETS2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ETS2
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, ELISA
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias ETS2IT1, human erythroblastosis virus oncogene homolog 210protein C-ets-2, oncogene ETS-2, v-ets avian erythroblastosis virus E2 oncogene homolog 2, v-ets avian erythroblastosis virus E26 oncogene homolog 2, v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ETS2 (NP_005230.1).,, Sequence:, SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2114
Target Species Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.