missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ETF1 (Human) Recombinant Protein

Human ETF1 partial ORF ( NP_004721.1, 338 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002107-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16127814

  • 545.00€ / 25µg

Estimated Shipment: 04-10-2022
to see stock.
Add to basket

Description

Description

  • Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Specifications

Specifications

NP_004721.1
eukaryotic translation termination factor 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ETF1
GST
2107
Wheat germ expression system
25 μg
D5S1995, ERF, ERF1, MGC111066, RF1, SUP45L1, TB3-1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers