missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ERR gamma/NR3B3 Antibody, Novus Biologicals™

ERR gamma/NR3B3 Antibody, Novus Biologicals™

Product Code. 18491212 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18491212 25 μL 25µL
18490532 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18491212 Supplier Novus Biologicals Supplier No. NBP19187325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ERR gamma/NR3B3 Polyclonal antibody specifically detects ERR gamma/NR3B3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ERR gamma/NR3B3
Applications Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias DKFZp781L1617, ERR gamma-2, ERR3, ERRG2, ERRgamma, Estrogen receptor-related protein 3, estrogen-related receptor gamma, FLJ16023, KIAA0832, NR3B3, Nuclear receptor subfamily 3 group B member 3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 2104
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.