missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERR alpha/NR3B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | ERR alpha/NR3B1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18209744
|
Novus Biologicals
NBP2-56812 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18645277
|
Novus Biologicals
NBP2-56812-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ERR alpha/NR3B1 Polyclonal specifically detects ERR alpha/NR3B1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| ERR alpha/NR3B1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cell Biology, Cell Cycle and Replication, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2101 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ERR1Estrogen receptor-like 1, ERRa, ESRL1ERR-alpha, estrogen-related receptor alphaERRalpha, NR3B1Nuclear receptor subfamily 3 group B member 1, steroid hormone receptor ERR1 | |
| ESRRA | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title