missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. R&D Systems™ ERK1 Inhibitor Peptide Set

R&D Systems™ ERK1 Inhibitor Peptide Set

Product Code. 18116222 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18116222 2 mg 2mg
18110564 5 mg 5mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18116222 Supplier R&D Systems™ Supplier No. NBP229333
 Restricted Item
Estimated Shipment: 13-11-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. For use in research applications

TRUSTED_SUSTAINABILITY

Specifications

Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Components ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Erk activation
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 2 mg
Product Type ERK1 Inhibitor Peptide Set
Molecular Weight (g/mol) 3795
Product Line Novus
Inhibitors ERK1
Form Lyophilized

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.