missing translation for 'onlineSavingsMsg'
Learn More
Learn More
eIF4G1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33508-100ul
This item is not returnable.
View return policy
Description
eIF4G1 Monoclonal antibody specifically detects eIF4G1 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Specifications
| eIF4G1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp686A1451, EIF4F, eIF-4G 1, EIF-4G1, EIF4-gamma, eIF-4-gamma 1, EIF4GI, EIF4Gp220, eucaryotic translation initiation factor 4G, eukaryotic translation initiation factor 4 gamma 1, eukaryotic translation initiation factor 4 gamma, 1, P220 | |
| A synthetic peptide corresponding to a sequence within amino acids 551-650 of human eIF4G1 (NP_937884.2).,, Sequence:, GSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLR | |
| 100 μL | |
| Cancer, DNA Repair, DNA replication Transcription Translation and Splicing, mTOR Pathway, Phospho Specific | |
| 1981 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction