missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EIF4EBP1 (Human) Recombinant Protein

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001978-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16104441

  • 335.00€ / 10µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Specifications

Specifications

AAH04459
eukaryotic translation initiation factor 4E binding protein 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EIF4EBP1
GST
1978
Wheat germ expression system
10 μg
4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers