missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ EIF4EBP1 (Human) Recombinant Protein
Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001978-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Specifications
| AAH04459 | |
| eukaryotic translation initiation factor 4E binding protein 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EIF4EBP1 | |
| GST |
| 1978 | |
| Wheat germ expression system | |
| 10 μg | |
| 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |