missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ EIF4EBP1 (Human) Recombinant Protein

Abnova™ EIF4EBP1 (Human) Recombinant Protein

Product Code. p-7164205
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
This item is not returnable. View return policy

Product Code. 16104441

Brand: Abnova™ H00001978P01.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Specifications

Accession Number AAH04459
Gene ID (Entrez) 1978
Name eukaryotic translation initiation factor 4E binding protein 1
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 10 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Gene Symbol EIF4EBP1
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato