missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33880
This item is not returnable.
View return policy
Description
DUSP26 Polyclonal specifically detects DUSP26 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| DUSP26 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q9BV47 | |
| DUSP26 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL | |
| 0.1 mL | |
| GPCR, Neuronal Cell Markers, Neurotransmission, Protein Phosphatase | |
| 78986 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DSP-4, dual specificity phosphatase 26 (putative), Dual specificity phosphatase SKRP3, dual specificity protein phosphatase 26, dual-specificity phosphatase SKRP3, DUSP24SKRP3, EC 3.1.3.16, EC 3.1.3.48, LDP4, LDP-4, Low-molecular-mass dual-specificity phosphatase 4, MAP kinase phosphatase 8, MGC1136, MGC2627, Mitogen-activated protein kinase phosphatase 8, MKP8, MKP-8, NATA1, Novel amplified gene in thyroid anaplastic cancer | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction