missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DULLARD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | DULLARD |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18601778
|
Novus Biologicals
NBP2-68840-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18603708
|
Novus Biologicals
NBP2-68840 |
100 μg |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DULLARD Polyclonal antibody specifically detects DULLARD in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| DULLARD | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CTD nuclear envelope phosphatase 1, DULLARD, dullard homolog, dullard homolog (Xenopus laevis), EC 3.1.3.16, HSA011916, NET56, Serine/threonine-protein phosphatase dullard | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol | |
| 23399 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title