missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLX5 Antibody (4C6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00001749-M09
This item is not returnable.
View return policy
Description
DLX5 Monoclonal antibody specifically detects DLX5 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
DLX5 | |
Monoclonal | |
Unconjugated | |
In 1x PBS, pH 7.4 | |
distal-less homeo box 5, distal-less homeobox 5, homeobox protein DLX-5 | |
DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH | |
0.1 mg | |
Neuroscience | |
1749 | |
Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
IgG2a κ |
Western Blot, ELISA, Immunocytochemistry | |
4C6 | |
Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence 10 μg/mL | |
NP_005212 | |
Mouse | |
IgG purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction