missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLX5 Antibody (4C6), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00001749-M09
This item is not returnable.
View return policy
Description
DLX5 Monoclonal antibody specifically detects DLX5 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
| DLX5 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| distal-less homeo box 5, distal-less homeobox 5, homeobox protein DLX-5 | |
| DLX5 (NP_005212, 191 a.a. ~ 279 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH | |
| 0.1 mg | |
| Neuroscience | |
| 1749 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Immunocytochemistry | |
| 4C6 | |
| Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence 10 μg/mL | |
| NP_005212 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction