missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dishevelled-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | Dishevelled-2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18215613
|
Novus Biologicals
NBP2-58480 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18611509
|
Novus Biologicals
NBP2-58480-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dishevelled-2 Polyclonal specifically detects Dishevelled-2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Dishevelled-2 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction, Wnt Signaling Pathway | |
| dishevelled 2 (homologous to Drosophila dsh), dishevelled, dsh homolog 2 (Drosophila), Dishevelled-2, DSH homolog 2, segment polarity protein dishevelled homolog DVL-2 | |
| DVL2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1856 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title