missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Defensin alpha 3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92456-0.1ml
This item is not returnable.
View return policy
Description
Defensin alpha 3 Polyclonal antibody specifically detects Defensin alpha 3 in Human samples. It is validated for Western Blot
Specifications
| Defensin alpha 3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DEF3, Defensin, alpha 3, defensin, alpha 3, neutrophil-specific, HNP3, HNP-3defensin 3, neutrophil-specific, HP3, HP-3, neutrophil defensin 3, neutrophil peptide 3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-94 of human DEFA3 (NP_005208.1). EPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 1668 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction