missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DEFB1 (Human) Recombinant Protein

Human DEFB1 full-length ORF ( AAH47677, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001672-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16104011

  • 335.00€ / 10µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Specifications

Specifications

AAH47677
defensin, beta 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DEFB1
GST
1672
Wheat germ expression system
10 μg
BD1, DEFB-1, DEFB101, HBD1, MGC51822
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers