missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DECR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35773-20ul
This item is not returnable.
View return policy
Description
DECR2 Polyclonal antibody specifically detects DECR2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| DECR2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| 2,4-dienoyl CoA reductase 2, peroxisomal, EC 1.3.1, EC 1.3.1.34, pDCR2,4-dienoyl-CoA reductase 2, PDCRshort chain dehydrogenase/reductase family 17C, member 1, peroxisomal 2,4-dienoyl-CoA reductase, SDR17C1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human DECR2 (NP_065715.1).,, Sequence:, GTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLG | |
| 20 μL | |
| Lipid and Metabolism | |
| 26063 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction