missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDX55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | DDX55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DDX55 Polyclonal specifically detects DDX55 in Human samples. It is validated for Western Blot.Specifications
| DDX55 | |
| Polyclonal | |
| Rabbit | |
| Q8NHQ9 | |
| 57696 | |
| Synthetic peptides corresponding to DDX55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55) The peptide sequence was selected from the N terminal of DDX55. Peptide sequence RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 55, DEAD box protein 55, EC 3.6.1, EC 3.6.4.13, FLJ16577, KIAA1595ATP-dependent RNA helicase DDX55, MGC33209 | |
| DDX55 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title