missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCAF12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
488.00€
Specifications
| Antigen | DCAF12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DCAF12 Polyclonal specifically detects DCAF12 in Human samples. It is validated for Western Blot.Specifications
| DCAF12 | |
| Polyclonal | |
| Rabbit | |
| Q5T6F0 | |
| 25853 | |
| Synthetic peptides corresponding to WDR40A(WD repeat domain 40A) The peptide sequence was selected from the middle region of WDR40A. Peptide sequence TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DDB1- and CUL4-associated factor 12, CT102, DDB1 and CUL4 associated factor 12, KIAA1892, TCC52, WDR40A | |
| DCAF12 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title