missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DC2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92350-0.1ml
This item is not returnable.
View return policy
Description
DC2 Polyclonal antibody specifically detects DC2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| DC2 | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| DC2, Hydrophobic protein HSF-28, oligosaccharyltransferase complex subunit, oligosaccharyltransferase complex subunit OSTC | |
| A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human OSTC (NP_067050.1). YDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG | |
| 0.1 mL | |
| Endocrinology, Signal Transduction | |
| 58505 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction