missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CYP4A11 (Human) Recombinant Protein
Human CYP4A11 full-length ORF ( AAH22851, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001579-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
Specifications
| AAH22851 | |
| cytochrome P450, family 4, subfamily A, polypeptide 11 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CYP4A11 | |
| GST |
| 1579 | |
| Wheat germ expression system | |
| 25 μg | |
| CP4Y, CYP4A2, CYP4AII | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |