missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CYB5 (Human) Recombinant Protein

Human CYB5 full-length ORF ( AAH15182, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001528-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103801

  • 508.00€ / 25µg
Estimated Shipment: 26-06-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
Specifications

Specifications

AAH15182
cytochrome b5 type A (microsomal)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CYB5A
GST
1528
Wheat germ expression system
25 μg
CYB5, MCB5
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers