missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CSNK2A2 (Human) Recombinant Protein

Human CSNK2A2 full-length ORF ( AAH08812.1, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001459-P01.25ug

Product Code. 16193631

Quantity

Estimated Shipment: 25-10-2024
to see stock.

Add to basket

This item is not returnable. View return policy

Description

Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Specifications

Accession Number	AAH08812.1
Name	casein kinase 2, alpha prime polypeptide
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CSNK2A2
Protein Tag	GST

Gene ID (Entrez)	1459
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	CK2A2, CSNK2A1, FLJ43934
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description