missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRYGA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
486.00€ - 741.00€
Specifications
| Antigen | CRYGA |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18389382
|
Bio-Techne
NBP3-17113-25UL |
25 μg |
486.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18333874
|
Novus Biologicals
NBP3-17113-100UL |
100 μg |
741.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CRYGA Polyclonal antibody specifically detects CRYGA in Human samples. It is validated for Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| CRYGA | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CRYG1, CRYG5, CRY-g-A | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CNSIRVDSGCWMLYERPNYQGHQYFLRRGKY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 1418 | |
| IgG | |
| Affinity purified |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto