missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CRYBB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | CRYBB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CRYBB3 Polyclonal specifically detects CRYBB3 in Human samples. It is validated for Western Blot.Specifications
| CRYBB3 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| Beta-B3 crystallin, beta-crystallin B3, CATCN2, CRYB3MGC125774, crystallin, beta B3, eye lens structural protein, MGC125772, MGC125773 | |
| CRYBB3 | |
| IgG | |
| 24 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P26998 | |
| 1417 | |
| Synthetic peptides corresponding to CRYBB3(crystallin, beta B3) The peptide sequence was selected from the middle region of CRYBB3. Peptide sequence LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title