missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Crossveinless-2/CV-2/BMPER Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58041
This item is not returnable.
View return policy
Description
Crossveinless-2/CV-2/BMPER Polyclonal specifically detects Crossveinless-2/CV-2/BMPER in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications
| Crossveinless-2/CV-2/BMPER | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| BMP binding endothelial regulator, BMP-binding endothelial regulator precursor protein, BMP-binding endothelial regulator protein, Bone morphogenetic protein-binding endothelial cell precursor-derived regulator, CRIM3, crossveinless 2, crossveinless-2, Cv2, CV-2, hCV2, KIAA1965, Protein crossveinless-2 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 168667 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunoprecipitation, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q8N8U9 | |
| BMPER | |
| Synthetic peptides corresponding to BMPER(BMP binding endothelial regulator) The peptide sequence was selected from the C terminal of BMPER. Peptide sequence NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Yeast: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction