missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CRHR2/CRF2 Polyclonal antibody specifically detects CRHR2/CRF2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | CRHR2/CRF2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Gene Alias | corticotropin releasing hormone receptor 2, corticotropin-releasing factor receptor 2, Corticotropin-releasing hormone receptor 2, CRF2, CRF2R, CRFR2, CRF-R2, CRF-R-2, CRFR-2, CRH2R, CRH-R2, CRH-R-2 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human CRHR2 (NP_001189404.1). PPPLQYAAGQSQMPKDQPLWALLEQYCHTIMTLTNLSGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHY |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?