missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CREB3L3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | CREB3L3 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18603746
|
Novus Biologicals
NBP2-38785-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18160278
|
Novus Biologicals
NBP2-38785 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CREB3L3 Polyclonal specifically detects CREB3L3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CREB3L3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q68CJ9 | |
| 84699 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDNATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| cAMP responsive element binding protein 3-like 3, cAMP-responsive element-binding protein 3-like protein 3, CREB/ATF family transcription factor, CREB-H, CREBHMGC126557, cyclic AMP-responsive element-binding protein 3-like protein 3, MGC126553, Transcription factor CREB-H | |
| CREB3L3 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title