missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-54775
This item is not returnable.
View return policy
Description
CPS1 Polyclonal specifically detects CPS1 in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CPS1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16 | |
| Rabbit | |
| 165 kDa | |
| 100 μL | |
| Primary | |
| Yeast: 77%. | |
| Human, Pig, Rat, Bovine, Canine, Canine, Equine, Guinea Pig, Rabbit, Yeast | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| P31327 | |
| CPS1 | |
| Synthetic peptides corresponding to CPS1(carbamoyl-phosphate synthetase 1, mitochondrial) The peptide sequence was selected from the middle region of CPS1. Peptide sequence YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI. | |
| Protein A purified | |
| RUO | |
| 1373 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction