missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ COX7B (Human) Recombinant Protein

Human COX7B full-length ORF ( AAH18386, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001349-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193431

  • 508.00€ / 25µg
Estimated Shipment: 26-08-2024
to see stock.
Add to basket

Description

Description

  • Sequence: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQVGIEWNLSPVGRVTPKEWRNQ
Specifications

Specifications

AAH18386
cytochrome c oxidase subunit VIIb
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
1349
Wheat germ expression system
25 μg
COX7B
GST
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers