missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX7A2L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56202
This item is not returnable.
View return policy
Description
COX7A2L Polyclonal specifically detects COX7A2L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| COX7A2L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| COX7ARcytochrome c oxidase subunit VII-related protein, COX7a-related protein, COX7RPmitochondrial, cytochrome c oxidase subunit VIIa polypeptide 2 like, Cytochrome c oxidase subunit VIIa-related protein, estrogen receptor binding CpG island, SIG81 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9167 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| COX7A2L | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVY | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction