missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CORIN (Human) Recombinant Protein

Name: Abnova&trade; CORIN (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16103046
Price: 335.00 EUR

Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00010699-Q01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16103046

Quantity

Estimated Shipment: 06-06-2024
to see stock.

Add to basket

Description

Sequence: CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA

Specifications

Accession Number	NP_006578
Name	corin, serine peptidase
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CORIN
Protein Tag	GST

Gene ID (Entrez)	10699
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	ATC2, CRN, Lrp4, MGC119742, TMPRSS10
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description