missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COPB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 624.00€
Specifications
| Antigen | COPB2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18245543
|
Novus Biologicals
NBP2-54952 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18682448
|
Novus Biologicals
NBP2-54952-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
COPB2 Polyclonal specifically detects COPB2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| COPB2 | |
| Polyclonal | |
| Rabbit | |
| Golgi Apparatus Markers, Membrane Trafficking and Chaperones, Neuroscience | |
| beta prime subunit, Beta'-coat protein, Beta'-COP, betaprime-COP, coatomer protein complex, subunit beta 2 (beta prime), coatomer subunit beta', p102 | |
| COPB2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 9276 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAFLARTYLPSQVSRVVKLWRENLSKVNQKAAE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title