missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 37/GJA4 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92410-0.02ml
This item is not returnable.
View return policy
Description
Connexin 37/GJA4 Polyclonal antibody specifically detects Connexin 37/GJA4 in Human samples. It is validated for Western Blot
Specifications
| Connexin 37/GJA4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| connexin 37, Connexin-37, Cx37, CX37connexin-37, gap junction alpha-4 protein, gap junction protein, alpha 4, 37kD (connexin 37), gap junction protein, alpha 4, 37kDa, gap junction protein, alpha 4, 37kDa (connexin 37) | |
| A synthetic peptide corresponding to a sequence within amino acids 229-333 of human Connexin 37/GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV | |
| 0.02 mL | |
| Cardiovascular Biology, Cell Biology, Cytoskeleton Markers, Immunology, Signal Transduction | |
| 2701 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction